Share this post on:

Product Name :
Trypsin Porcine

Description :
Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.

Background :

Biological activity:

Protein number :

Synonyms:

Amino acid sequence :
VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN

Purity :

Source :
E.coli.

Stablity :
Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
KIR2DL1 Proteinmanufacturer
VEGFR-1 Proteinsupplier
Popular categories:
PDGF-R-beta
IL-10R2

Share this post on:

Author: Proteasome inhibitor