Product Name :
Streptavidin
Description :
Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa.
Background :
Biological activity:
Protein number :
P22629
Synonyms:
Amino acid sequence :
MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.
Purity :
Greater than 98.0% as determined by SDS-PAGE and HPLC.
Source :
Escherichia Coli.
Stablity :
Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TNFRSF11B/OPG ProteinGene ID
Animal-Free SUMO Protease ProteinMedChemExpress
Popular categories:
Amphiregulin
Carboxypeptidase B1